DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RecQ5 and Recql

DIOPT Version :9

Sequence 1:NP_729983.1 Gene:RecQ5 / 39594 FlyBaseID:FBgn0027375 Length:1058 Species:Drosophila melanogaster
Sequence 2:XP_006237679.1 Gene:Recql / 312824 RGDID:1311071 Length:645 Species:Rattus norvegicus


Alignment Length:466 Identity:160/466 - (34%)
Similarity:247/466 - (53%) Gaps:55/466 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VHEALKKHFGHSKFKSDLQEKAVKCAVKKKQDVYVSMPTGSGKSLCFQLPGLMSENQITIVFSPL 71
            |...|:..|...||: .||.:.|...:.:| |:::.||||.|||||:|||.|.|:. .|:|..||
  Rat    79 VKHVLRDVFKLQKFR-PLQLETVNATMARK-DIFLVMPTGGGKSLCYQLPALCSDG-FTLVICPL 140

  Fly    72 LALIKDQIDHLTKLKVPADSLNSKMSTKERDRVIMDLKAVRTNLKFLYITPEQ-AATKFFQDLLQ 135
            ::|::||:..|.:|.:.|..|||..|.:....|..::....::||.:|:|||: |.:|.|...|:
  Rat   141 ISLMEDQLMVLQQLGISATMLNSSSSKEHVKCVHTEMMNKNSHLKLIYVTPEKIAKSKMFMSRLE 205

  Fly   136 TLHKHNKLAYFAVDEAHCVSQWGHDFRPDYLKLGELRSKYSDVIWLALTATASREVKEDIYKQLR 200
            ..::..:|...||||.||.|||||||||||..||.|:.::.::..:.|||||:..|.:|..|.|.
  Rat   206 KAYEAGRLTGVAVDEVHCCSQWGHDFRPDYKALGILKRQFPNISLIGLTATATNHVLKDAQKILC 270

  Fly   201 LHQPVAQFSTPSF-RKNLFYDIVYKNSIEDDFQHLADFARHCLGNPKEFKDTPKPQRGCGIVYCR 264
            :.:.:.  .|.|| |.||:|::..|.|..:||  :.:.|....|..|         ...||:||.
  Rat   271 VEKCLT--FTASFNRPNLYYEVRQKPSSAEDF--IENIANLINGRYK---------GKSGIIYCF 322

  Fly   265 TRDQVERMAIGVTKQGIGAVAYHAGLKTGERTEVQEAWMRGDQPIICATNSFGMGVDKPSVRFVI 329
            ::...|::.|.:.|.|:.|..|||.::..:||:|...|...:..::.||.:||||:|||.|||||
  Rat   323 SQKDSEQVTISLQKLGVRAGTYHANMEPEDRTKVHTQWSANELQVVVATVAFGMGIDKPDVRFVI 387

  Fly   330 HWDVPQNVAAYYQESGRAGRDGLQSYCRLYYGREDVRSI--RFLLQNDAHRARGRGDKELLTERA 392
            |..:.:::..|||||||||||..::.|.||||..|:..|  ..:::|...:              
  Rat   388 HHSMSKSMENYYQESGRAGRDDWRADCILYYGFGDIFRISSMVVMENVGQQ-------------- 438

  Fly   393 IKQFEKITEFCER-TTCRHKLFSDFFGD--PTPDCSGQCDVCKRPKKAEKALEIFHRLCMDDAFK 454
             |.:|.:: :|:. :.||..|.:..|.:  ....|:..||.|                |.||:|:
  Rat   439 -KLYEMVS-YCQNISKCRRALIAQHFDEVWNADACNKMCDNC----------------CKDDSFE 485

  Fly   455 SHISLQDCADL 465
            .....:.|..|
  Rat   486 KKNITEHCQAL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RecQ5NP_729983.1 RecQ 6..>442 CDD:223588 154/441 (35%)
DEAD 37..193 CDD:278688 67/156 (43%)
HELICc <257..359 CDD:238034 43/101 (43%)
RecQ_Zn_bind 364..431 CDD:292742 13/71 (18%)
RecqlXP_006237679.1 recQ_fam 82..543 CDD:129701 159/463 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.