DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and Cyp313a1

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:583 Identity:118/583 - (20%)
Similarity:197/583 - (33%) Gaps:193/583 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGIWDIPGP 65
            :.:.||||:..:...|....|.:|..:.|:                               ||||
  Fly     2 LTINLLLAVGALFWIYFLWSRRRLYFLMLK-------------------------------IPGP 35

  Fly    66 KRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNRDD--LEKVLK 128
            ..:|.||:....::.::|    ||......||: ||..:|..|.   |:..:..||.  :|.:..
  Fly    36 IGLPILGSSLENIITYKR----KLSFRTKYLNK-YGSTILTWMG---PVPFIVTRDPKVVEDIFS 92

  Fly   129 YP-----SKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSI----------- 177
            .|     |::.....|..:            ..|::.:|.|.|...|.....|.           
  Fly    93 SPDCHNKSQHIVNAITSCM------------GNGLLGKQDPHWLDRRKHFNPSFKQDLLLSFFHI 145

  Fly   178 --TSPRVLQNFLPALNAVCDDFI---------ELLR--------------ARRD---PDTLVVPN 214
              ...:||.|.|       |.::         |:||              .:.|   .:..:|.:
  Fly   146 FDAETKVLMNLL-------DTYVDKGEIDVVPEMLRWSFKIAAQTTMGSEVKHDEHFKNGSLVES 203

  Fly   215 FEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTK 279
            ||.|.:...|..:..|:..|                         .||:...|            
  Fly   204 FESLISHSTLNILMPLVQNR-------------------------MISKICGY------------ 231

  Fly   280 TYRDFARAEDL--IYDVISEIIDHELEELKKSAACEDDEAAGLRSIFLN-ILEL---KDLDIRDK 338
               |..||::.  |..::..:::.::..|.|:.:  |.|:    :|.:| .:||   .|:...|.
  Fly   232 ---DKLRADNFSRIQKMLDNVVNKKVNPLPKTDS--DPES----NIVINRAMELYRKGDITYMDV 287

  Fly   339 KSAIIDFIAAGIETLANTLLFVLSSVTGDPGAMPRILSEFCEYRDTNILQDA---------LTNA 394
            ||.....||||.:|.|.|:...|..:...|.....:..|.     ..:..||         :...
  Fly   288 KSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEEL-----NGVFPDAGHFGITYPDMQKL 347

  Fly   395 TYTKACIQESYRLRPTAFCLARILEEDMELSGYSLNAGTVVLCQNMIACHKDSNFQGAKQFTPER 459
            .|.:..|:|:.||.|.....||..:.|:.||...|....||:..:|...|::          ||.
  Fly   348 DYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRN----------PEV 402

  Fly   460 WIDPATENFTVNVDN----------ASIVVPFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVS 512
            | .|..:||  |.||          ....:||..|:|:|.|.::..|.....|.:::..:.:|
  Fly   403 W-GPDADNF--NPDNFLAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKIS 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 109/521 (21%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 109/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24305
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.