DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and CYP27A1

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_000775.1 Gene:CYP27A1 / 1593 HGNCID:2605 Length:531 Species:Homo sapiens


Alignment Length:505 Identity:124/505 - (24%)
Similarity:230/505 - (45%) Gaps:78/505 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KRRRRGIWDIPGPKRIPFLG-TKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVH 116
            :||:|.:      :.||.|| .::.|.||.:.|.: :||::......:||.:.:..:...:. |:
Human    51 RRRQRSL------EEIPRLGQLRFFFQLFVQGYAL-QLHQLQVLYKAKYGPMWMSYLGPQMH-VN 107

  Fly   117 LYNRDDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPR 181
            |.:...||:|::...|||.|...|   ::::.|.....:.|....:|..|.:||.:|...:..|.
Human   108 LASAPLLEQVMRQEGKYPVRNDME---LWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPA 169

  Fly   182 VLQNFLPALNAVCDDF---IELLRARRDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDT 243
            ....:..|.|.|.|||   ::.|||...... .|.:..:|.....|||:|.::..:|:|  .:..
Human   170 EAALYTDAFNEVIDDFMTRLDQLRAESASGN-QVSDMAQLFYYFALEAICYILFEKRIG--CLQR 231

  Fly   244 KQPQKISQLAAAVKQLFISQRDSYYGLGLWKY----FP-TKTYRDFARAEDLIYDVISEIIDHEL 303
            ..|:.......::..:|   ::|.|...|.|:    .| .|.|.|...|   |:....::||.:|
Human   232 SIPEDTVTFVRSIGLMF---QNSLYATFLPKWTRPVLPFWKRYLDGWNA---IFSFGKKLIDEKL 290

  Fly   304 EELKKSAACEDDEAAGLRSIFLN-----ILELKDLDIRDKKSAIIDFIAAGIETLANTLLFVLSS 363
            |:::...     :|||...|.::     :|....|..|:...::.:.:.||::|.:|||.:.|..
Human   291 EDMEAQL-----QAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYH 350

  Fly   364 VTGDP-----------GAMPRILSEFCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARI 417
            ::.||           |.:|  ..:..:::|       ..:....||.::|:.||.|.....:||
Human   351 LSKDPEIQEALHEEVVGVVP--AGQVPQHKD-------FAHMPLLKAVLKETLRLYPVVPTNSRI 406

  Fly   418 LEEDMELSGYSLNAGTVVLCQNMIACHKDSNFQGAKQFTPERWI---DPATENFTVNVDNASIVV 479
            :|:::|:.|:.....|..:..:.:.....:.|...:.|.|.||:   .|||.    .:.:....|
Human   407 IEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATP----RIQHPFGSV 467

  Fly   480 PFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLETEFEFLLAPKT 529
            |||.|.|:|.|:|..|:|:.||||:::            .:::.:|||:|
Human   468 PFGYGVRACLGRRIAELEMQLLLARLI------------QKYKVVLAPET 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 119/492 (24%)
CYP27A1NP_000775.1 p450 61..526 CDD:306555 120/489 (25%)
Sterol-binding. /evidence=ECO:0000255 384..398 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.