DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and CYP11B2

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_000489.3 Gene:CYP11B2 / 1585 HGNCID:2592 Length:503 Species:Homo sapiens


Alignment Length:498 Identity:122/498 - (24%)
Similarity:205/498 - (41%) Gaps:85/498 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GTKWIFLLFFRR-----YKMTKLHEVYADL------NRQYGDIVLEVMPSNVPIVHLYNRDDLEK 125
            |.:|:.||...|     :...::|:.:.:|      |.....:|..::|           :|:||
Human    46 GNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLP-----------EDVEK 99

  Fly   126 VLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNFLPAL 190
            :.:..|.:|.|...|..|.|||.|..:   .|:....||.|:..|..|...:.||:.:|.|||.:
Human   100 LQQVDSLHPCRMILEPWVAYRQHRGHK---CGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMV 161

  Fly   191 NAVCDDFIELLRAR-----RDPDTL-VVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQKI 249
            :||..||.:.|:.:     |...|| |.|:.....    :||....:.|.|:|.:.   ..|...
Human   162 DAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYT----IEASNLALFGERLGLVG---HSPSSA 219

  Fly   250 S---------QLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDHELEE 305
            |         ...:.|:.:|:.:       .|.::...|.:::...|.|.|:......|....:|
Human   220 SLNFLHALEVMFKSTVQLMFMPR-------SLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQE 277

  Fly   306 LKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFVLSSVTGDPGA 370
            |   |........|   |...:|...:|.:...|:..::..|..::|.|..||..|..:..:|..
Human   278 L---AFNRPQHYTG---IVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDV 336

  Fly   371 MPRILSE-------FCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARILEEDMELSGYS 428
            ...:..|       ..|:.     |.|.|.....:|.::|:.||.|....|.|::..|:.|..|.
Human   337 QQILRQESLAAAASISEHP-----QKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYH 396

  Fly   429 LNAGTVVLCQNMIACHKDSNFQGAKQFTPERWID--PATENFTVNVDNASIVVPFGVGRRSCPGK 491
            :.|||:|...........:.|...:::.|:||:|  .:..||.        .||||.|.|.|.|:
Human   397 IPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFH--------HVPFGFGMRQCLGR 453

  Fly   492 RFVEMEVVLLLAKMVLAFDVSFV--KPLETEFEFLLAPKT-PL 531
            |..|.|::|||..::..|.|..:  :.::..:.|:|.|.| ||
Human   454 RLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 118/492 (24%)
CYP11B2NP_000489.3 p450 42..454 CDD:365848 108/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.