DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and Cyp27b1

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_034139.2 Gene:Cyp27b1 / 13115 MGIID:1098274 Length:507 Species:Mus musculus


Alignment Length:529 Identity:130/529 - (24%)
Similarity:220/529 - (41%) Gaps:103/529 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RGIWDIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNRD 121
            |.:.|||||..:.||..      .|.:..:::|||:......:||.|..... ..:..|::.:..
Mouse    35 RSLSDIPGPSTLSFLAE------LFCKGGLSRLHELQVHGAARYGPIWSGSF-GTLRTVYVADPT 92

  Fly   122 DLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNF 186
            .:|::|:..|..|.|..   ...:.:.|.....:.|::...|..||||||.|...:..|:....:
Mouse    93 LVEQLLRQESHCPERCS---FSSWAEHRRRHQRACGLLTADGEEWQRLRSLLAPLLLRPQAAAGY 154

  Fly   187 LPALNAVCDDFIELLRARRDPDT----LVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQPQ 247
            ...|:.|..|.:..||.:|...:    ||:....|... .|||::..::||.|:|  .::.:.|.
Mouse   155 AGTLDNVVRDLVRRLRRQRGRGSGLPGLVLDVAGEFYK-FGLESIGAVLLGSRLG--CLEAEVPP 216

  Fly   248 KISQLAAAVKQLFIS------QRDSYYGL--GLWKYFPTKTYRD----FARAEDLIYDVISEIID 300
            .......||..:|:|      ..:..:.|  |.|    .:..||    ||.|:..:         
Mouse   217 DTETFIHAVGSVFVSTLLTMAMPNWLHHLIPGPW----ARLCRDWDQMFAFAQRHV--------- 268

  Fly   301 HELEE----LKKSAACEDD-------------EAAGLRSIFLNILELKDLDIRDKKSAIIDFIAA 348
             ||.|    ::.....|:|             |...::||..|:.||               :.|
Mouse   269 -ELREGEAAMRNQGKPEEDMPSGHHLTHFLFREKVSVQSIVGNVTEL---------------LLA 317

  Fly   349 GIETLANTLLFVLSSVTGDPGAMPRILSEF-------CEYRDTNILQDALTNATYTKACIQESYR 406
            |::|::|||.:.|..::..|.....:.||.       |.:....    ||:.....||.|:|..|
Mouse   318 GVDTVSNTLSWTLYELSRHPDVQTALHSEITAGTRGSCAHPHGT----ALSQLPLLKAVIKEVLR 378

  Fly   407 LRPTAFCLARILEEDMELSGYSLNAGTVV-LCQNMIACHKD-SNFQGAKQFTPERWI--DPATEN 467
            |.|.....:|:.:.|:.:..|.:...|:| ||.  .|..:| :.|.....|.|.||:  .|....
Mouse   379 LYPVVPGNSRVPDRDIRVGNYVIPQDTLVSLCH--YATSRDPTQFPDPNSFNPARWLGEGPTPHP 441

  Fly   468 FTVNVDNASIVVPFGVGRRSCPGKRFVEMEVVLLLAKMVLAFDV---SFVKPLETEFEFLLAPKT 529
            |      ||:  |||.|:|||.|:|..|:|:.:.|::::..|:|   ....|::.....:|.|:.
Mouse   442 F------ASL--PFGFGKRSCIGRRLAELELQMALSQILTHFEVLPEPGALPIKPMTRTVLVPER 498

  Fly   530 PLSLRLSDR 538
            .::|:..||
Mouse   499 SINLQFVDR 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 123/511 (24%)
Cyp27b1NP_034139.2 p450 41..504 CDD:278495 125/518 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.