DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and Cyp11b2

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_034121.4 Gene:Cyp11b2 / 13072 MGIID:88584 Length:500 Species:Mus musculus


Alignment Length:490 Identity:117/490 - (23%)
Similarity:211/490 - (43%) Gaps:56/490 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PKRI-PFLG------TKWIFLL-FFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNRD 121
            ||.: ||..      .||:.:: ..|......||.....:.|:.|.|....: ....||.:...:
Mouse    32 PKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSV-GKTQIVSVMLPE 95

  Fly   122 DLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNF 186
            |.||:.:..|..|.|...|..|.:|:.|..|.   |:....||.|:..|..|..::.||:.:|.|
Mouse    96 DAEKLHQVESMLPRRMHLEPWVAHRELRGLRR---GVFLLNGPEWRLNRLRLNRNVLSPKAVQKF 157

  Fly   187 LPALNAVCDDFIELLRAR-----RDPDTLVVPNFEELANLMGLEAVCTLMLGRRMGFLAIDTKQP 246
            :|.::.|..||:|.|:.:     |...|:.|.  :.|.|.. :||....:.|.|:|.|..|. .|
Mouse   158 VPMVDMVARDFLETLKEKVLQNARGSLTMDVQ--QSLFNYT-IEASNFALFGERLGLLGHDL-SP 218

  Fly   247 QKI-------SQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDHELE 304
            ..:       |...:..:.||:.:       .|.::..|:.:::...|.|:|.:..:..|....:
Mouse   219 GSLKFIHALHSMFKSTSQLLFLPK-------SLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQ 276

  Fly   305 ELKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFVLSSVTGDPG 369
            ||:..:      :.....|...::....|.:...|:..::..|..::|.|..|:..|..:..:|.
Mouse   277 ELRLGS------SQTYSGIVAELISQGSLPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPD 335

  Fly   370 AMPRILSEFCEYRDTNIL---QDALTNATYTKACIQESYRLRPTAFCLARILEEDMELSGYSLNA 431
            ....:..|... .:.:|.   |.|:::....:|.::|:.||.|....|.|||..|:.|..|.:.|
Mouse   336 VQKALRQESLA-AEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILSSDLVLQNYHVPA 399

  Fly   432 GTVVLCQNMIACHKDSNFQGAKQFTPERWIDPATENFTVNVDNASIVVPFGVGRRSCPGKRFVEM 496
            ||:||..........:.|...:::.|:||:: ...:|.        .:.||.|.|.|.|:|..|:
Mouse   400 GTLVLLYLYSMGRNPAVFPRPERYMPQRWLE-RKRSFQ--------HLAFGFGVRQCLGRRLAEV 455

  Fly   497 EVVLLLAKMVLAFDVSFVK--PLETEFEFLLAPKT 529
            |::|||..::..|.|..::  .::..:.|:|.|.:
Mouse   456 EMMLLLHHILKTFQVETLRQEDVQMAYRFVLMPSS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 116/487 (24%)
Cyp11b2NP_034121.4 p450 42..496 CDD:365848 113/480 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.