DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment shd and Cyp11b1

DIOPT Version :9

Sequence 1:NP_001261843.1 Gene:shd / 39592 FlyBaseID:FBgn0003388 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001028401.2 Gene:Cyp11b1 / 110115 MGIID:88583 Length:501 Species:Mus musculus


Alignment Length:505 Identity:112/505 - (22%)
Similarity:215/505 - (42%) Gaps:82/505 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PKRI-PFLG------TKWIFLL-FFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNRD 121
            ||.: ||..      .||:.:: ..|......||.....:.|:.|.|....: ....||.:...:
Mouse    34 PKTLQPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQVFRELGPIFRHSV-GKTQIVFVTLPE 97

  Fly   122 DLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSPRVLQNF 186
            |:||:.:..|.:|.|.|.|..:::|:.|.   ...|:....||.|...|..|..::.||:.:|.|
Mouse    98 DVEKLYQVESTHPCRMPLESWIVHRELRG---LGRGVFLLNGPEWYFNRLQLNPNVLSPKAVQKF 159

  Fly   187 LPALNAVCDDFIELLRARRDPDTLVVPNFEELANLMG--------------LEAVCTLMLGRRMG 237
            :|.::.:..||::.|:.:.            |.::.|              :||...::.|.|:|
Mouse   160 VPLVDGIARDFVDNLKKKM------------LESVHGSFSMDFQSSVFNYTIEASHFVLFGERLG 212

  Fly   238 FLAIDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIIDH- 301
            .:..|. .|..:..|.........:.:..|....|.::..|:.:::...:.|.|.:.:::.|.: 
Mouse   213 LIGRDL-SPDSLKFLHTLHSMFKTTTQLLYLPRSLTRWTSTRVWKENLESWDFISEYVTKCIKNV 276

  Fly   302 --ELEELKKSAACEDDEAAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFVLSSV 364
              ||.|.:..:.....|....|::.::.::...:::          ||...:|.:..|:.....:
Mouse   277 YRELAEGRPQSWSVTAELVAERTLSMDAIQANSMEL----------IAGSTDTTSTPLVMTFFEL 331

  Fly   365 TGDPGAMPRILSEFCEYRDTNIL---QDALTNATYTKACIQESYRLRPTAFCLARILEEDMELSG 426
            ..:|.....:..|... .:.:|.   |.|:::....:|.::|:.||.|....|.|||..|:.|..
Mouse   332 ARNPDVQQALRQESLA-AEASIAANPQKAMSDLPLLRAALKETLRLYPVGTFLERILSSDLVLQN 395

  Fly   427 YSLNAGTVVLCQNMIACHKD-SNFQGAKQFTPERWIDPATENFTVNVDNASIVVPFGVGRRSCPG 490
            |.:.||| ||..|:.:..:: :.|...:::.|:||:: ...:|.        .:.||.|.|.|.|
Mouse   396 YHVPAGT-VLNVNLYSMGRNPAVFPRPERYMPQRWLE-RKRSFK--------HLAFGFGVRQCLG 450

  Fly   491 KRFVEMEVVLLLAKMVLAFDVSFVKPLETE--------FEFLLAP-KTPL 531
            :|..|.|::|||..::.:|.|      ||:        :.|:|.| .:||
Mouse   451 RRLAEAEMMLLLHHVLKSFHV------ETQEKEDVRMAYRFVLMPSSSPL 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
shdNP_001261843.1 p450 63..528 CDD:299894 110/500 (22%)
Cyp11b1NP_001028401.2 p450 44..497 CDD:278495 108/495 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0159
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D185685at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.