DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gbs-70E and GAC1

DIOPT Version :10

Sequence 1:NP_648708.2 Gene:Gbs-70E / 39588 FlyBaseID:FBgn0036428 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_014821.3 Gene:GAC1 / 854350 SGDID:S000005704 Length:793 Species:Saccharomyces cerevisiae


Alignment Length:111 Identity:30/111 - (27%)
Similarity:46/111 - (41%) Gaps:25/111 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DEESIVVGTIKVKNIDFQKEIIVRVTWDDWKSQQDIFCTYARAYGPATCAHVVFDTFSFKITLPP 303
            |:.|.:.|.:.|||:.|:|.:.::.|::.|:....:...:.|......      |.|.|.|.|..
Yeast   253 DDSSKITGLVYVKNLSFEKYLEIKFTFNSWRDIHYVTANFNRTINSNV------DEFKFTIDLNS 311

  Fly   304 SS-----KR--------------LEFCICYRTNETEYWDNNDGKNY 330
            ..     ||              :|.|..|..|...|:|||:||||
Yeast   312 LKYILLIKRIITMEKNTSSCPLNIELCCRYDVNNETYYDNNNGKNY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gbs-70ENP_648708.2 PBD_PPP1R3 <136..198 CDD:455118
CBM_21 224..332 CDD:427265 30/111 (27%)
GAC1NP_014821.3 CBM_21 237..359 CDD:427265 30/111 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.