DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and PHT3;2

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_190454.1 Gene:PHT3;2 / 824046 AraportID:AT3G48850 Length:363 Species:Arabidopsis thaliana


Alignment Length:316 Identity:168/316 - (53%)
Similarity:215/316 - (68%) Gaps:6/316 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PVVEPQPVEGRQIAAAAT--PVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRL 90
            |::.|   ....:::..|  .:|...:..|..|..|||.|.:.|:||||.|||.:.|||::||.:
plant    34 PLISP---TNSSVSSNGTSFAIATPNEKVEMYSPAYFAACTVAGMLSCGITHTAITPLDVIKCNM 95

  Fly    91 QVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAY 155
            |:|..||||:...||.|:.|:|.:|..:||.||||||||||..|:||||..|..|::|:|.|.|.
plant    96 QIDPLKYKNITSAFKTTIKEQGLKGFTRGWSPTLLGYSAQGAFKYGLYEYAKKYYSDIVGPEYAA 160

  Fly   156 LYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPL 220
            .|:|.:|||.|||||..||:||.|.||.||::||.||:|....:.:||::|.||....:||||||
plant   161 KYKTLIYLAGSASAEIVADVALCPMEAVKVRVQTQPGFARGLSDGLPKIIKSEGFRGLHKGLVPL 225

  Fly   221 WMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVV 285
            |.|||||||||||.||.||||:||.|:|.|:.:|:|..||.|:||.|||||:|||::|||||.:|
plant   226 WGRQIPYTMMKFATFENTVELIYKKVMPTPKEECSKPVQLGVSFAGGYIAGIFCAIISHPADNLV 290

  Fly   286 SKLNQAKGASAISVAKSLGFSGM-WNGLTPRIIMIGTLTALQWFIYDGVKVALGIP 340
            |.||.:|||:.....|.||..|| ..||..||.||||||..||.|||.|||..|:|
plant   291 SFLNNSKGATVADAVKRLGLWGMLTRGLPLRIFMIGTLTGAQWVIYDAVKVLAGLP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 47/83 (57%)
Mito_carr <175..245 CDD:278578 42/69 (61%)
Mito_carr 260..338 CDD:278578 47/78 (60%)
PHT3;2NP_190454.1 Mito_carr 63..152 CDD:395101 49/88 (56%)
Mito_carr 161..250 CDD:395101 54/88 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1862
eggNOG 1 0.900 - - E1_KOG0767
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 362 1.000 Inparanoid score I582
OMA 1 1.010 - - QHG55239
OrthoDB 1 1.010 - - D963446at2759
OrthoFinder 1 1.000 - - FOG0001887
OrthoInspector 1 1.000 - - mtm1078
orthoMCL 1 0.900 - - OOG6_101022
Panther 1 1.100 - - O PTHR45671
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.