DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and PHT3;3

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_179319.1 Gene:PHT3;3 / 816233 AraportID:AT2G17270 Length:309 Species:Arabidopsis thaliana


Alignment Length:297 Identity:125/297 - (42%)
Similarity:189/297 - (63%) Gaps:6/297 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVA 109
            |.|.::.|. |..|..::.:|.:||:||.||||..:.|||::|..:||:..||.::..||...:.
plant     2 TRVKSKLDE-ELSSPWFYTVCTMGGMLSAGTTHLAITPLDVLKVNMQVNPVKYNSIPSGFSTLLR 65

  Fly   110 EEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFAD 174
            |.|...|.:||...||||..||.|:|||||.||..|::::...|    |||:|..:||||:.|||
plant    66 EHGHSYLWRGWSGKLLGYGVQGGCRFGLYEYFKTLYSDVLPNHN----RTSIYFLSSASAQIFAD 126

  Fly   175 IALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTV 239
            :||.||||.||::||.|.:|....:..|::.:.||:..|::||.|||.|.:|::|:.|:.||::|
plant   127 MALCPFEAIKVRVQTQPMFAKGLLDGFPRVYRSEGLAGFHRGLFPLWCRNLPFSMVMFSTFEQSV 191

  Fly   240 ELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKSLG 304
            |.:|:.::.|.:.||:|.:||.||..|||.||....::|:|||||:|.|...|..:.:...:::|
plant   192 EFIYQKIIQKRKQDCSKAQQLGVTCLAGYTAGAVGTIISNPADVVLSSLYNNKAKNVLQAVRNIG 256

  Fly   305 FSGMWNGLTP-RIIMIGTLTALQWFIYDGVKVALGIP 340
            |.|::....| ||.::|.:..||||.||.:||..|.|
plant   257 FVGLFTRSLPVRITIVGPVITLQWFFYDAIKVLSGFP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 37/83 (45%)
Mito_carr <175..245 CDD:278578 30/69 (43%)
Mito_carr 260..338 CDD:278578 32/78 (41%)
PHT3;3NP_179319.1 PTZ00169 17..287 CDD:240302 116/273 (42%)
Mito_carr 23..105 CDD:278578 38/81 (47%)
Mito_carr 114..197 CDD:278578 38/82 (46%)
Mito_carr 212..289 CDD:278578 31/76 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0767
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55239
OrthoDB 1 1.010 - - D963446at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45671
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1083
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.