DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG4743

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:318 Identity:78/318 - (24%)
Similarity:134/318 - (42%) Gaps:48/318 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 GRQIAAAATPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLV 101
            |.:.||.:..:..|:   .....|:|.....||:... .....:.|:|.||.|||.:...::   
  Fly     6 GLESAAGSVAIKMQE---PVNKLKFFHALVAGGVAGM-VVDIALFPIDTVKTRLQSELGFWR--- 63

  Fly   102 HGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEII-GEENAYLYRTSLYLAA 165
                    ..|.||:.||..|...|.:......|..||..|...:.:. .:::.|     :::||
  Fly    64 --------AGGFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFLSSVTQTKDSPY-----VHMAA 115

  Fly   166 SASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGV-NAFYKGLVPLWMRQIPYTM 229
            :::||..|.:...|.|.||.:.||:.|...:..:.:.:..:.||: ...|:|.....||:||:::
  Fly   116 ASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGFGSTIMREIPFSL 180

  Fly   230 MKFACFERTVELLYKYV----VPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSK--- 287
            ::|.        |::|.    .|....|.|.....:    .|.:||...|.::.|.|||.::   
  Fly   181 IQFP--------LWEYFKLQWTPLTGFDSTPFSVAL----CGAVAGGISAGLTTPLDVVKTRIML 233

  Fly   288 -----LNQAKGASAI--SVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALG 338
                 ||:.:.|..|  .:....||||::.|..||::.|....|..:..||.....||
  Fly   234 AERESLNRRRSARRILHGIYLERGFSGLFAGFVPRVLWITLGGAFFFGFYDLTTRILG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 21/83 (25%)
Mito_carr <175..245 CDD:278578 17/70 (24%)
Mito_carr 260..338 CDD:278578 23/87 (26%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 22/87 (25%)
PTZ00168 25..281 CDD:185494 70/284 (25%)
Mito_carr 199..291 CDD:278578 25/95 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441810
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.