DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and DPCoAC

DIOPT Version :10

Sequence 1:NP_524069.2 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_650891.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster


Alignment Length:166 Identity:52/166 - (31%)
Similarity:78/166 - (46%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IGGILSCGTTHTFVVPLDLVKCRLQVDQ--AKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSA 129
            :.|.|:..|:.:...||||.:.|:.|..  ..|:.|...|.....|||.|.|.:|::.|:||...
  Fly   173 LAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIP 237

  Fly   130 QGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTI-PGY 193
            .....|..||..|.:|.|::|....   .|.:.||..|:|......|..|.:..:.::||: ...
  Fly   238 YAGTSFFTYETLKREYYEVVGNNKP---NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT 299

  Fly   194 ANNFR-----EAVPKMLKEEGV-NAFYKGLVPLWMR 223
            |...|     |.:.|:.:|||| |.|||||...|::
  Fly   300 AGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_524069.2 Mito_carr 58..142 CDD:395101 24/76 (32%)
Mito_carr <175..245 CDD:395101 19/56 (34%)
Mito_carr 260..338 CDD:395101
DPCoACNP_650891.1 PTZ00169 77..336 CDD:240302 52/166 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.