DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Dic1

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001287313.1 Gene:Dic1 / 41640 FlyBaseID:FBgn0027610 Length:280 Species:Drosophila melanogaster


Alignment Length:288 Identity:64/288 - (22%)
Similarity:114/288 - (39%) Gaps:40/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GGILSCG---TTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSA 129
            ||:.|.|   .||    ||||:|..||..|. :.::.........|:|......|...::|....
  Fly    13 GGLASVGAAMVTH----PLDLIKVTLQTQQG-HLSVAQLIPKLAREQGVLVFYNGLSASVLRQLT 72

  Fly   130 QGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQT---IP 191
            ....:||:||..| ||.      |...:...:.||.::.  ....|...|.:...|::|.   :|
  Fly    73 YSTARFGVYEAGK-KYV------NTDSFGGKVALAGASG--LVGGIVGTPADMVNVRMQNDVKLP 128

  Fly   192 -----GYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPR 251
                 .|.|.| :.:.::.::||....:.|......|.|..|:.:.|.:::|  .:|....|..:
  Fly   129 PQQRRNYNNAF-DGLVRVYRQEGFKRLFSGATAATARGILMTIGQIAFYDQT--KIYLLATPYFQ 190

  Fly   252 ADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGA------SAISVAKSLGFSGMWN 310
                  :.|:..|.|..:||.....::.|.||:.::...||..      ..:.....||..|.:.
  Fly   191 ------DNLVTHFTASLVAGTIATTLTQPLDVLKTRSMNAKPGEFNGLWDIVKHTAKLGPLGFFK 249

  Fly   311 GLTPRIIMIGTLTALQWFIYDGVKVALG 338
            |..|..:.:|..|.:.:...:.:::..|
  Fly   250 GYVPAFVRLGPHTIITFVFLEQLRLKFG 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 22/76 (29%)
Mito_carr <175..245 CDD:278578 17/77 (22%)
Mito_carr 260..338 CDD:278578 17/83 (20%)
Dic1NP_001287313.1 Mito_carr 10..92 CDD:278578 26/90 (29%)
PTZ00169 13..273 CDD:240302 63/282 (22%)
Mito_carr 89..184 CDD:278578 20/99 (20%)
Mito_carr 189..278 CDD:278578 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441803
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.