DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and GC1

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:326 Identity:86/326 - (26%)
Similarity:136/326 - (41%) Gaps:59/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 AAAATPVANQQDSCEFGSTKYFALC------GIGGILSCGTTHTFVVPLDLVKCRLQVDQ----- 94
            |..|||:...|.       :.|||.      ||.||:..    |.|.||||||.|||..|     
  Fly     5 ATIATPLPQPQH-------QQFALLPKIINGGIAGIIGV----TCVFPLDLVKTRLQNQQIGPNG 58

  Fly    95 -AKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYR 158
             ..|.::...|:.|...||..|:.:|....:|..:.:...|....:.|:.|    :..::..|..
  Fly    59 ERMYNSMFDCFRKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYFRHK----LTTKDGKLPL 119

  Fly   159 TSLYLAASASAEFFADIALAPFEAAKVKIQ---TIPGYANNFREAVPK---------MLKEEGVN 211
            || .:.|...|..|..|...|.|..|:::|   .:...|....:.|.|         ::|::|:.
  Fly   120 TS-QMVAGGLAGAFQIIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIF 183

  Fly   212 AFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLI-VTFAAGYIAGVFCA 275
            ..|||:....:|.:.::::.|..|....:|       .||.:...||.:. .:|.||..||...|
  Fly   184 GLYKGIGATGLRDVTFSIIYFPLFATLNDL-------GPRRNDGSGEAVFWCSFLAGLAAGSTAA 241

  Fly   276 VVSHPADVVVSKLNQAKGA------SAIS--VAKSL---GFSGMWNGLTPRIIMIGTLTALQWFI 329
            :..:|.|||.::|...|.|      ..||  :.|:|   |.:..:.|...|:|:|..|..:...:
  Fly   242 LAVNPFDVVKTRLQAIKKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPLFGIAQTV 306

  Fly   330 Y 330
            |
  Fly   307 Y 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 28/95 (29%)
Mito_carr <175..245 CDD:278578 17/81 (21%)
Mito_carr 260..338 CDD:278578 24/83 (29%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 23/84 (27%)
Mito_carr 115..213 CDD:278578 22/98 (22%)
Mito_carr 226..307 CDD:278578 23/80 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.