DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG16736

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:293 Identity:61/293 - (20%)
Similarity:108/293 - (36%) Gaps:61/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 GILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLV--HGFKVTVAEEGARGLAKGWFPTLLGYSAQG 131
            |:|...|......|::||:..:|.:...:..|.  |.|:: :|..|..|...|.....|..:...
  Fly     6 GLLIKTTAQLLSHPMELVRVNMQANVIHHSRLSINHMFRL-MARHGLPGFYYGIVAACLRCTVHT 69

  Fly   132 LCKFGL-YELFKVKYAEIIGEENAYL-----YRTSLYLAASASAEFFADIALAPFEAAKVKIQ-- 188
            :..:.| |.|          ::|.|:     |.||:.|..:.   |:..:...||....|..|  
  Fly    70 MSTYTLFYNL----------QDNKYVLMLQPYNTSMVLGITG---FWGGVLATPFAKLAVIRQAD 121

  Fly   189 -TIPGY-ANNFREAVPKMLKEEGVNAFYKGLVPLWMR---QIPYTMMKFACFERT-VELLYKYVV 247
             |...| ..|:|.             |::||..::.:   ...:|..|......| |.:||..:.
  Fly   122 LTRGSYERRNYRN-------------FWRGLKCMYAKGGFTYLFTGWKINSISSTAVAVLYTPIS 173

  Fly   248 PKPRADCTKGEQL-------IVTFAAGYIAGVFCAVVSHPADVVVS-KLNQAKGASAIS------ 298
            .|.....:...:|       ::|.|   :.|....|:..|.|.:.: .||::......|      
  Fly   174 DKVHTVISWFHRLDEPWLSDLITMA---LTGSIITVIMTPVDALATLTLNESSHYGRTSYPYLYR 235

  Fly   299 -VAKSLGFSGMWNGLTPRIIMIGTLTALQWFIY 330
             :.:..|:.|.:.|..|.::.:...|.|..|:|
  Fly   236 KIIRKHGYKGFFFGWKPALMALIPHTVLATFVY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 18/75 (24%)
Mito_carr <175..245 CDD:278578 17/77 (22%)
Mito_carr 260..338 CDD:278578 18/86 (21%)
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578 18/85 (21%)
Mito_carr 187..277 CDD:278578 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.