DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG2616

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:319 Identity:68/319 - (21%)
Similarity:120/319 - (37%) Gaps:82/319 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 THTFVVPLDLVKCRLQVDQAK------YKN--LVHGF--------------------------KV 106
            |..|:.|||::|.|:|..|:.      |.|  :.|.|                          |:
  Fly   104 TACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWDALMKI 168

  Fly   107 TVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEII------GEENAYL----YRTSL 161
            : ..||...|..|..|||:......:..|..||.||.:|.:|.      .:|..:|    .:.||
  Fly   169 S-RHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDTKKSL 232

  Fly   162 ----YLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWM 222
                .:.:..:|...|...::|.|..:.|:|..........:.|..::..:||...::||.|..:
  Fly   233 PSVVPMMSGVTARICAVTVVSPIELVRTKMQAQRQTYAQMLQFVRSVVALQGVWGLWRGLRPTIL 297

  Fly   223 RQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQ--LIVTFAAGYIAGVFCAVVSHPADVVV 285
            |.:|::.:.:..:|..            :.:...|.|  ..::|.||.:||...|:|:.|.|||.
  Fly   298 RDVPFSGIYWPIYESL------------KQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPFDVVK 350

  Fly   286 SKLNQAKGASAI-------------------SVAKSLGFSGMWNGLTPRIIMIGTLTAL 325
            :......|...|                   .:.::.|..|::.|..||::.:....|:
  Fly   351 THEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAI 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 24/99 (24%)
Mito_carr <175..245 CDD:278578 13/69 (19%)
Mito_carr 260..338 CDD:278578 19/85 (22%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 26/103 (25%)
Mito_carr 230..321 CDD:278578 17/102 (17%)
Mito_carr 321..425 CDD:278578 20/89 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.