DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Dic4

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:284 Identity:61/284 - (21%)
Similarity:114/284 - (40%) Gaps:51/284 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VVPLDLVKCRLQVDQAKYKNL-----VHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYE 139
            |.|:|:||..:|:.:.|...|     :|..|      |..|...|:...:|.........|.:|:
  Fly    37 VAPIDIVKTHMQIQRQKRSILGTVKRIHSLK------GYLGFYDGFSAAILRQMTSTNIHFIVYD 95

  Fly   140 L-FKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQT---IPGY-ANNFR- 198
            . .|::|.    :.::||.:..|...|.|....|.    .|.:...|::||   .|.| ..|:: 
  Fly    96 TGKKMEYV----DRDSYLGKIILGCVAGACGSAFG----IPTDLINVRMQTDMKEPPYKRRNYKH 152

  Fly   199 --EAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVE-----LLYKYVVPKPRADCTK 256
              :.:.::.||||..|.|||             ...|.|:.::.     ..|..:..:.|.:.:.
  Fly   153 VFDGLIRIPKEEGWKALYKG-------------GSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204

  Fly   257 GEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKS------LGFSGMWNGLTPR 315
            .:.|.:.|.......:..:.::||.|||.:.:..::.....:|.::      .|..|.:.|..|.
  Fly   205 NDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGEFRTVFQASVHMMRFGVMGPYRGFVPT 269

  Fly   316 IIMIGTLTALQWFIYDGVKVALGI 339
            |:.....|.|.:.:|:.:::..||
  Fly   270 IVRKAPATTLLFVLYEQLRLHFGI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 16/67 (24%)
Mito_carr <175..245 CDD:278578 18/81 (22%)
Mito_carr 260..338 CDD:278578 16/83 (19%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 59/277 (21%)
Mito_carr 26..100 CDD:278578 16/68 (24%)
Mito_carr 104..201 CDD:278578 25/113 (22%)
Mito_carr 211..292 CDD:278578 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441805
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.