DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and SCaMC

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_729802.1 Gene:SCaMC / 39415 FlyBaseID:FBgn0052103 Length:583 Species:Drosophila melanogaster


Alignment Length:307 Identity:74/307 - (24%)
Similarity:129/307 - (42%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQ 130
            ||.|.:|    .|...|||.:|..||| |.:...:.....:.:.|.|:|.:.:|....:|..:.:
  Fly   293 GIAGAVS----RTCTAPLDRIKVYLQV-QTQRMGISECMHIMLNEGGSRSMWRGNGINVLKIAPE 352

  Fly   131 GLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKI---QTIPG 192
            ...||..||..|   ..|.|::.:..........|.|:|...:...:.|.|..|.::   :|  |
  Fly   353 TAFKFAAYEQMK---RLIRGD
DGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT--G 412

  Fly   193 YANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKG 257
            ......:|..|:.|:|||.:||:|.||..:..:||..:..|.:|   .|..:|:     |:....
  Fly   413 QYAGIADAAVKIYKQEGVRSFYRGYVPNILGILPYAGIDLAVYE---TLKRRYI-----ANHDNN 469

  Fly   258 EQ--LIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAIS---------------------- 298
            ||  .:|..|.|..:.....:.|:|..:|.::| ||:.|..|:                      
  Fly   470 EQPSFLVLLACGSTSSTLGQLCSYPLALVRTRL-QAQAAETIANQKRKTQIPLKSSDAHSGEETM 533

  Fly   299 ------VAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGI 339
                  :.:..|.:|::.|:||..:.:....::.:.:|:....||||
  Fly   534 TGLFRKIVRQEGLTGLYRGITPNFLKVLPAVSISYVVYEYTSRALGI 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 22/75 (29%)
Mito_carr <175..245 CDD:278578 21/72 (29%)
Mito_carr 260..338 CDD:278578 18/105 (17%)
SCaMCNP_729802.1 FRQ1 100..247 CDD:227455
EFh 116..176 CDD:238008
EFh 186..242 CDD:238008
Mito_carr 285..370 CDD:278578 24/84 (29%)
Mito_carr 375..463 CDD:278578 24/92 (26%)
Mito_carr 470..581 CDD:278578 23/112 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.