DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and slc25a3a

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:XP_005164785.1 Gene:slc25a3a / 393688 ZFINID:ZDB-GENE-040426-1673 Length:377 Species:Danio rerio


Alignment Length:348 Identity:237/348 - (68%)
Similarity:278/348 - (79%) Gaps:6/348 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETARNSPFRTPMSMARCDAAAPVVEPQPVEGRQIAAAATPVANQQDSCEFGSTKYFALCGIGGIL 71
            :.||::||:.|:...:.|...   |.|..: |::|||:...|  :.|||:||.||:||||.||||
Zfish    30 QLARSNPFQAPLFSIKTDQQH---EKQQTK-RKLAAASYDDA--EVSCEYGSNKYYALCGFGGIL 88

  Fly    72 SCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFG 136
            |||.|||.||||||:|||:|||..|||::.:||.||:.|:|.|||.|||.||.:|||.|||||||
Zfish    89 SCGLTHTAVVPLDLIKCRIQVDPEKYKSIFNGFSVTLREDGFRGLGKGWAPTFIGYSMQGLCKFG 153

  Fly   137 LYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQTIPGYANNFREAV 201
            .||:||..|.:::|||||||:|||:||||||||||||||||||.||.||:|||.|||||..||..
Zfish   154 FYEIFKALYNDMLGEENAYLWRTSVYLAASASAEFFADIALAPMEACKVRIQTQPGYANTLRECA 218

  Fly   202 PKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAA 266
            |||..|||:||||||:.|||:||||||||||||||||||.||||||||||::|:|.|||:|||.|
Zfish   219 PKMHAEEGLNAFYKGVYPLWLRQIPYTMMKFACFERTVETLYKYVVPKPRSECSKPEQLVVTFVA 283

  Fly   267 GYIAGVFCAVVSHPADVVVSKLNQAKGASAISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYD 331
            ||||||||||||||||.|||.||:.||:||:.|.|.||..|:|.||..|||||||||||||||||
Zfish   284 GYIAGVFCAVVSHPADSVVSVLNKEKGSSAVEVLKRLGPVGVWKGLFARIIMIGTLTALQWFIYD 348

  Fly   332 GVKVALGIPRPPPPEMPASLKAK 354
            .|||...:||||||:||.|||.|
Zfish   349 SVKVYFRLPRPPPPDMPESLKRK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 58/83 (70%)
Mito_carr <175..245 CDD:278578 54/69 (78%)
Mito_carr 260..338 CDD:278578 58/77 (75%)
slc25a3aXP_005164785.1 Mito_carr 75..166 CDD:278578 61/90 (68%)
PTZ00169 85..351 CDD:240302 198/265 (75%)
Mito_carr <192..262 CDD:278578 54/69 (78%)
Mito_carr 277..355 CDD:278578 58/77 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576448
Domainoid 1 1.000 147 1.000 Domainoid score I4451
eggNOG 1 0.900 - - E1_KOG0767
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 522 1.000 Inparanoid score I1217
OMA 1 1.010 - - QHG55239
OrthoDB 1 1.010 - - D423866at33208
OrthoFinder 1 1.000 - - FOG0001887
OrthoInspector 1 1.000 - - mtm6465
orthoMCL 1 0.900 - - OOG6_101022
Panther 1 1.100 - - O PTHR45671
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.