DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG7514

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_647923.1 Gene:CG7514 / 38571 FlyBaseID:FBgn0035567 Length:301 Species:Drosophila melanogaster


Alignment Length:285 Identity:69/285 - (24%)
Similarity:119/285 - (41%) Gaps:44/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GIGGILSCGTTHTFVVPLDLVKCRLQVD--QAKYKN----LVHGFKVTVAEEGARGLAKGWFPTL 124
            |:.|:|  ||  ..|.||||||.|:|:.  ..:||:    |:..||    .||...|..|....|
  Fly    20 GLAGML--GT--CIVQPLDLVKTRMQISATTGEYKSSFDCLLKVFK----NEGILALYNGLSAGL 76

  Fly   125 LGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQT 189
            :..:.....:.|.|::....|.:........|....:.:.|.|....|.:    |.|.|.:::.:
  Fly    77 MRQATYTTARMGFYQMEIDAYRKQFNAPPTVLASMGMGILAGAFGAMFGN----PAEVALIRMMS 137

  Fly   190 ----IPGYANNFR---EAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVV 247
                .|....|:.   .|..:::|:|||...:||.:|...|.:...|::.|.:.:......:|. 
  Fly   138 DNRLPPAERRNYTGVLNAFVRIVKDEGVITLWKGCMPTVGRAMIVNMVQLASYSQLKAAFSEYF- 201

  Fly   248 PKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGAS-------AISVAKSLGF 305
                      ..|.:..||..::|:...:.|.|.|:..:::.|.|.|.       .:.|:|:.|.
  Fly   202 ----------SGLSLHIAAAMMSGLLTTIASMPLDMAKTRIQQQKTAEYKGTMDVLMKVSKNEGI 256

  Fly   306 SGMWNGLTPRIIMIGTLTALQWFIY 330
            :.:|.|.||.:..:|..|... ||:
  Fly   257 ASLWKGFTPYLCRLGPHTVFA-FIF 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 26/81 (32%)
Mito_carr <175..245 CDD:278578 16/76 (21%)
Mito_carr 260..338 CDD:278578 21/78 (27%)
CG7514NP_647923.1 PTZ00169 16..287 CDD:240302 69/285 (24%)
Mito_carr 19..90 CDD:278578 25/77 (32%)
Mito_carr 104..201 CDD:278578 20/100 (20%)
Mito_carr 207..284 CDD:278578 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.