DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and PMP34

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001246615.1 Gene:PMP34 / 38532 FlyBaseID:FBgn0052250 Length:314 Species:Drosophila melanogaster


Alignment Length:311 Identity:68/311 - (21%)
Similarity:124/311 - (39%) Gaps:54/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQA-KYKNLVHGFKVTVAEEGARGLAKGWFPTLLG 126
            |:.|..|  .|....|| .|||.|:.|||:::| ..::.....|..|..||.:.|.:|..|.|  
  Fly    19 AVSGAAG--GCIAMSTF-YPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVL-- 78

  Fly   127 YSAQGLCKFG---LYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEA--AKVK 186
               |.||...   .|....:|.....|..:.:.....|.|.:.|.  ....:...||..  .:::
  Fly    79 ---QSLCISNFVYFYTFHALK
AVASGGSPSQHSALKDLLLGSIAG--IINVLTTTPFWVVNTRLR 138

  Fly   187 IQTIPG-------YANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYK 244
            ::.:.|       :..|..|.:..:.::||:...:.|.:|..| .:....::|..:|.....:.:
  Fly   139 MRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLM-LVSNPALQFMMYEMLKRNIMR 202

  Fly   245 YVVPKPRADCTKGEQ-LIVTFAAGYIAGVFCAVVSHPADVVV------SKLNQAKGASA------ 296
            :         |.||. .:..|..|.||..|..|:::|..:|.      ||.:.:|.:::      
  Fly   203 F---------TGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPR 258

  Fly   297 --------ISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGI 339
                    ||:.:..|..|::.||..:|:......||.:..|:.:...:|:
  Fly   259 TESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGM 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 26/82 (32%)
Mito_carr <175..245 CDD:278578 12/78 (15%)
Mito_carr 260..338 CDD:278578 21/97 (22%)
PMP34NP_001246615.1 Mito_carr 15..96 CDD:278578 26/84 (31%)
Mito_carr 105..202 CDD:278578 15/99 (15%)
Mito_carr 214..303 CDD:278578 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.