DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Shawn

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001027071.1 Gene:Shawn / 3772641 FlyBaseID:FBgn0031039 Length:387 Species:Drosophila melanogaster


Alignment Length:358 Identity:78/358 - (21%)
Similarity:133/358 - (37%) Gaps:82/358 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QIAAAATPVA---NQQDSCEFGSTKYFALCGIGGILSCGT----THTFVVPLDLVKCRLQVDQ-- 94
            |.|||:..:|   :|..|....:...|.:..:..:.|..|    |..|:.|||::|.|||..|  
  Fly     9 QFAAASAAMAAASSQNPSKATMTDPRFRIRPLQQVASACTGAMVTACFMTPLDVIKTRLQAQQQA 73

  Fly    95 ---------------------------------AKYKNLVHGFKVTVAEEGARGLAKGWFPTLLG 126
                                             .::...:..|......||...|..|..|||:.
  Fly    74 LLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDAFIKISRTEGIGSLWSGLSPTLIS 138

  Fly   127 YSAQGLCKFGLYELFKVKYAEI----------IGEENAYLYRTSLYLAASASAEFFADIALAPFE 181
            .....:..|..||.||.::.:|          |..:..:.....:.|.|..|....|...::|.|
  Fly   139 ALPSTIIYFVAYEQFKARFTDIHYKYTRRPDTIAHDIPHPIPFLVPLLAGVSGRILAVTCVSPVE 203

  Fly   182 AAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYV 246
            ..:.|:|:...........:.::::.:||...::||.|..:|.:|::.:.:.|:|   .|...:.
  Fly   204 LIRTKMQSQRMTHAEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYE---YLKSSFG 265

  Fly   247 VPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVV------------VSKLNQAKGASAISV 299
            |.:|        ....:||||.|:|...|.::.|.|||            :...|..|..:..||
  Fly   266 VVEP--------TFSFSFAAGAISGSVAATITTPFDVVKTHEQIEFGEKFIFSDNPPKQVATKSV 322

  Fly   300 AKSL-------GFSGMWNGLTPRIIMIGTLTAL 325
            |..|       |...:::||.||:..:....|:
  Fly   323 AMRLASIYRMGGVPAIFSGLGPRLFKVAPACAI 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 24/122 (20%)
Mito_carr <175..245 CDD:278578 14/69 (20%)
Mito_carr 260..338 CDD:278578 23/85 (27%)
ShawnNP_001027071.1 Mito_carr 39..159 CDD:278578 25/119 (21%)
Mito_carr 178..265 CDD:278578 18/89 (20%)
Mito_carr 268..371 CDD:278578 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.