DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG18327

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:298 Identity:65/298 - (21%)
Similarity:120/298 - (40%) Gaps:47/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IGGILSCGTTHTFVVPLDLVKCRLQVD---------QAKYKNLVHGFKVTVAE-EGARGLAKGWF 121
            :||:.:.| ...|..|::::|.|:|:.         ...||::...| ||||: :|..||.||..
  Fly     8 LGGVAAMG-AGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAF-VTVAKNDGILGLQKGLA 70

  Fly   122 PTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVK 186
            |.|.........:..:| ...|:...:...:....:...::..|....  ......:||...|.:
  Fly    71 PALCFQFVINSFRLSIY-THAVEKGWVHNNKGEISFAKGMFWGALGGV--VGSYCASPFFLIKTQ 132

  Fly   187 IQT------IPGYAN---NFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELL 242
            :|.      ..||.:   :..:|:.|:.::.||...::|.:....|....:.::.|.|.:...||
  Fly   133 LQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIAVFGQAKSLL 197

  Fly   243 YKY-VVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKL-NQAKGAS---------- 295
            .:. ||..|         .|::|.:|..||.|.::...|.|||.::| ||...|.          
  Fly   198 KENGVVTHP---------TILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIYYRGWL 253

  Fly   296 --AISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYD 331
              .:::.:|.|..|::.|..|..:.....:.|....:|
  Fly   254 DCVLTILRSEGVYGLYKGFWPIYLRSAPYSTLVLLFFD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 23/84 (27%)
Mito_carr <175..245 CDD:278578 16/78 (21%)
Mito_carr 260..338 CDD:278578 21/85 (25%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 22/80 (28%)
PTZ00169 5..293 CDD:240302 65/298 (22%)
Mito_carr 101..201 CDD:278578 17/101 (17%)
Mito_carr 204..296 CDD:278578 22/97 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441294
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.