DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG8026

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:200 Identity:59/200 - (29%)
Similarity:87/200 - (43%) Gaps:28/200 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GSTKYFALCGIGGILSCGTTHTFVVPLDLVKCR--LQVD---QAKYKNLVHGFKVTVAEEGARGL 116
            |.|.........|||:...|:    |:.:||.|  ||.|   .|:|:.::|.......|||.|||
  Fly   121 GPTMNMLAAAESGILTLLLTN----PIWVVKTRLCLQCDAASSAEYRGMIHALGQIYKEEGIRGL 181

  Fly   117 AKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYR---------TSLYLAASASAEFF 172
            .:|:.|.:||.| .|..:|..||..|..|.|         ||         |:.|||.:|.::..
  Fly   182 YRGFVPGMLGVS-HGAIQFMTYEELKNAYNE---------YRKLPIDTKLATTEYLAFAAVSKLI 236

  Fly   173 ADIALAPFEAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFER 237
            |..|..|::..:.::|......|...:.:.:..:.||...|||||.....|.:|..|:.|..:|.
  Fly   237 AAAATYPYQVVRARLQDHHHRYNGTWDCIKQTWRFEGYRGFYKGLKASLTRVVPACMVTFLVYEN 301

  Fly   238 TVELL 242
            ....|
  Fly   302 VSHFL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 30/88 (34%)
Mito_carr <175..245 CDD:278578 16/67 (24%)
Mito_carr 260..338 CDD:278578
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 53/179 (30%)
Mito_carr 23..115 CDD:278578
Mito_carr 119..213 CDD:278578 34/105 (32%)
Mito_carr 220..307 CDD:278578 22/86 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441769
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.