DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Dic3

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:297 Identity:70/297 - (23%)
Similarity:125/297 - (42%) Gaps:47/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GIGGILSCGTTHTFVVPLDLVKCRLQV-DQAKYKNLVHGFKVTVAEEGA----RGLAKGWFPTLL 125
            |:...::...||    |:||:|.:||. .||..|.:....|......|.    .|::..||..|.
  Fly    16 GVCAAIAVTGTH----PIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWFRQLT 76

  Fly   126 GYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQT- 189
             |:.   .:|.|||         .|::.....:.|..:|.:..|.....|...|.:...|::|. 
  Fly    77 -YTT---TRFALYE---------AGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQND 128

  Fly   190 --IP-----GYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVELLYKYVV 247
              :|     .|.:.| :.:.::.|||||::.::|.||...|.:..|:...|.:::..::|     
  Fly   129 VKLPEEKRRNYKHVF-DGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML----- 187

  Fly   248 PKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAK-------GASAISVAKSLGF 305
               :.....||.:.:.||...|||....|::.|.||:.:....|:       |.:.:|.||. |.
  Fly   188 ---KIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQ-GP 248

  Fly   306 SGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGIPRP 342
            ...:.|..|.:|.:...|.:.:.:|:..::..|...|
  Fly   249 LAFYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 23/80 (29%)
Mito_carr <175..245 CDD:278578 19/77 (25%)
Mito_carr 260..338 CDD:278578 20/84 (24%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 68/285 (24%)
Mito_carr 15..91 CDD:278578 24/91 (26%)
Mito_carr 93..187 CDD:278578 21/94 (22%)
Mito_carr 200..281 CDD:278578 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441807
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.