DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and CG4995

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:294 Identity:79/294 - (26%)
Similarity:112/294 - (38%) Gaps:58/294 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LCGIGGILSCGTTHTFVVPLDLVKCRLQVD---QAKYKNLVHGFKVTVAEEGARGLAKGWFPTLL 125
            |.|..|:|   ..|    |.|.||..||.|   ..|||...|.|:..|..:...||.:|....:.
  Fly    49 LGGAAGVL---VGH----PFDTVKVHLQTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMG 106

  Fly   126 GYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASAS--AEFFADIALAPFEAAKVKIQ 188
            |........||:|.    ....:..:.|:.   ||.:.|.|.:  |:.|   ..||.|.||.::|
  Fly   107 GIGLVNAIVFGVYG----NVQRLSNDPNSL---TSHFFAGSIAGVAQGF---VCAPMELAKTRLQ 161

  Fly   189 TIPGYANNFREAVP-----KMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFE---RTVELLYKY 245
            ......:..:...|     .::|.||:...:|||....:|.||.....|..||   |.||     
  Fly   162 LSTQVDSGIKFTGPIHCLKYIVKTEGIRGAFKGLTATILRDIPGFASYFVSFEYLMRQVE----- 221

  Fly   246 VVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLN-QAKGASA-----ISVAKSLG 304
                     |.|  :..|..||..||:...:..:|.|||.:.:. .|.||:|     |..|.. |
  Fly   222 ---------TPG--VAYTLMAGGCAGMSSWLACYPIDVVKTHMQADALGANAKYNGFIDCAMK-G 274

  Fly   305 FSG-----MWNGLTPRIIMIGTLTALQWFIYDGV 333
            |..     .:.||...:|....:.|..:|:...|
  Fly   275 FRNEGPQYFFRGLNSTLIRAFPMNAACFFVVSWV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 25/80 (31%)
Mito_carr <175..245 CDD:278578 22/77 (29%)
Mito_carr 260..338 CDD:278578 23/85 (27%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 25/86 (29%)
PTZ00169 41..295 CDD:240302 76/279 (27%)
Mito_carr 128..218 CDD:278578 26/95 (27%)
Mito_carr 221..304 CDD:278578 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.