DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and MME1

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_609093.1 Gene:MME1 / 33987 FlyBaseID:FBgn0031881 Length:299 Species:Drosophila melanogaster


Alignment Length:307 Identity:74/307 - (24%)
Similarity:119/307 - (38%) Gaps:61/307 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KYFALCGIGGILSCGTTHTFVVPLDLVKCRLQV-------DQAKYKNLVHGFKVTVAEEGARGLA 117
            |.|...|:||:.:....|    |||.:|.|||.       ...:||.::.....|...||.||..
  Fly    16 KSFIAGGVGGMCNVLVGH----PLDTIKVRLQTMPTPPPGQPPRYKGVIDCAARTFRYEGFRGFY 76

  Fly   118 KGWFPTLLGYSAQGLCKFGLY----ELF------KVKYAEIIGEENAYLYRTSLYLAASASAEFF 172
            :|....|:|.:......|.:|    .||      ::.|.:|              .||.|.|...
  Fly    77 RGISAPLVGVTPIYAVDFAVYAAGKRLFQTDDHIRLTYPQI--------------FAAGALAGVC 127

  Fly   173 ADIALAPFEAAKVKIQTI-----PGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKF 232
            :.:...|.:..||.:||.     |...|...:...|:.::.|:.:.:||.....:|..| |...|
  Fly   128 SALVTVPTDRIKVLLQTQTVSNGPLLYNGTIDTAAKLYRQGGIRSLFKGTCACILRDSP-TGFYF 191

  Fly   233 ACFERTVELLYKYVVPKPRADCTKGE-QLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGAS- 295
            ..:|...||        .|.....|: ....|..:|..||:....::.|.||:.|:|..|...: 
  Fly   192 VTYEFLQEL--------ARKKSANGKISTTSTILSGGTAGIVFWTLAVPFDVLKSRLQSAPEGTY 248

  Fly   296 ---AISVAKSL----GFSGMWNGLTPRIIMIGTLTALQWFIYDGVKV 335
               ..||.::|    |...::.|:.|.::.....||..:|   ||::
  Fly   249 KHGIRSVFRNLMATEGPKALFRGILPILLRAFPSTAAVFF---GVEL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 27/98 (28%)
Mito_carr <175..245 CDD:278578 18/74 (24%)
Mito_carr 260..338 CDD:278578 21/84 (25%)
MME1NP_609093.1 Mito_carr 10..107 CDD:278578 27/94 (29%)
Mito_carr 111..205 CDD:278578 25/116 (22%)
Mito_carr 208..297 CDD:278578 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441717
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.