DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Ucp4C

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_608976.1 Gene:Ucp4C / 33832 FlyBaseID:FBgn0031757 Length:335 Species:Drosophila melanogaster


Alignment Length:297 Identity:71/297 - (23%)
Similarity:121/297 - (40%) Gaps:53/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IGGILSCGTTHTFVVPLDLVKCRLQVD--QAKYK-NLVHGFKVTVAE----EGARGLAKGWFPTL 124
            :...:......:.|.|||:.|.|:|||  |||.. ..:..|:.|:..    ||.:.|..|:...:
  Fly    41 VNTFIGANLAESCVFPLDVAKTRMQVDGEQAKKTGKAMPTFRATLTNMIRVEGFKSLYAGFSAMV 105

  Fly   125 LGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPFEAAKVKIQT 189
            .........:..||::|:..:. ...|.|..:.:..:.|..|.:|...|.....||:..||::||
  Fly   106 TRNFIFNSLRVVLYDVFRRPFL-YQNERNEEVLKIYMALGCSFTAGCIAQALANPFDIVKVRMQT 169

  Fly   190 IP-----GY---ANNFREAVPKMLKEEGVNAFYKGLVPLWMRQI--------PYTMMKFACFERT 238
            ..     ||   .|:..:|...:.:..|:.:.:||:.|..||..        .|.:.| ..|:|.
  Fly   170 EGRRRQLGYDVRVNSMVQAFVDIYRRGGLPSMWKGVGPSCMRACLMTTGDVGSYDISK-RTFKRL 233

  Fly   239 VELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSK-LNQAKGAS------- 295
            ::|               .|.|.:.|.:...||:..:|:|.||||:.|: :||....|       
  Fly   234 LDL---------------EEGLPLRFVSSMCAGLTASVLSTPADVIKSRMMNQPVDESGKNLYYK 283

  Fly   296 -AISVAKSL----GFSGMWNGLTPRIIMIGTLTALQW 327
             ::...:.|    |...::.||.|....:|..:.|.|
  Fly   284 NSLDCVRKLVREEGVLTLYKGLMPTWFRLGPFSVLFW 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 20/81 (25%)
Mito_carr <175..245 CDD:278578 21/85 (25%)
Mito_carr 260..338 CDD:278578 22/81 (27%)
Ucp4CNP_608976.1 Mito_carr 49..124 CDD:278578 21/74 (28%)
Mito_carr 137..232 CDD:278578 23/95 (24%)
Mito_carr 237..329 CDD:278578 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.