DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and colt

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:312 Identity:84/312 - (26%)
Similarity:130/312 - (41%) Gaps:38/312 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TPVANQQDSCEFGSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQV-------DQAKYKNLVH 102
            |...|.....:....|.|...|.|||.:..:.|    |||.:|.|||.       :|..|:....
  Fly     2 TTTENVSTERKANPVKSFLTGGFGGICNVLSGH----PLDTIKVRLQTMPRPAPGEQPLYRGTFD 62

  Fly   103 GFKVTVAEEGARGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASA 167
            ....|:..||.|||.||....|.|.:......|..|.|.|.....   .|:|.|....:::|.|.
  Fly    63 CAAKTIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQR---GEDAKLTYPQIFVAGSF 124

  Fly   168 SAEFFADIALAPFEAAKVKIQTIPGYA-----NNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPY 227
            |. .|:.:.:||.|..||.:||..|..     |...:...|:.||.|:.:.:||.....:|.:|.
  Fly   125 SG-LFSTLIMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPA 188

  Fly   228 TMMKFACFERTVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAK 292
            ..:.|..:|...:      |.|.:::..:.......||.| :||:...::..||||:.|:|..|.
  Fly   189 NGLYFLVYEALQD------VAKSKSETGQISTASTIFAGG-VAGMAYWILGMPADVLKSRLQSAP 246

  Fly   293 GAS----AISVAKSL----GFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVA 336
            ..:    ..||.|.|    |...::.|:||.::......|..:|   |:::|
  Fly   247 EGTYKHGIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFF---GIELA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 29/90 (32%)
Mito_carr <175..245 CDD:278578 19/74 (26%)
Mito_carr 260..338 CDD:278578 24/85 (28%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 30/98 (31%)
Mito_carr 112..202 CDD:395101 24/96 (25%)
Mito_carr 210..299 CDD:395101 24/90 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441715
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.