DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp2 and Ant2

DIOPT Version :9

Sequence 1:NP_001246757.1 Gene:Mpcp2 / 39587 FlyBaseID:FBgn0026409 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001259432.1 Gene:Ant2 / 32008 FlyBaseID:FBgn0025111 Length:307 Species:Drosophila melanogaster


Alignment Length:304 Identity:63/304 - (20%)
Similarity:113/304 - (37%) Gaps:38/304 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 GSTKYFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQA--------KYKNLVHGFKVTVAEEGA 113
            |..|.|.:..:.|.:|.....|.|.|::.||..|||.:.        :||.:|..|.....|:|.
  Fly    13 GDLKSFLMDFMMGGVSAAIAKTAVAPIERVKLILQVQEVSKQIAADQRYKGIVDCFIRIPKEQGF 77

  Fly   114 RGLAKGWFPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALA 178
            ....:|....::.|.......|...:::|..:...:.:...:....:..||:..:|...:...:.
  Fly    78 SSFWRGNLANVIRYFPTQALNFAFKDVYKSVFLGGVDKHKQFWRHFAGNLASGGAAGATSLCFVY 142

  Fly   179 PFEAAKVKIQTIPGYANNFRE------AVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFER 237
            |.:.|:.::....|...| ||      .:.|::|.:|....|:|.:......:.|....|..::.
  Fly   143 PLDFARTRLAADVGKGGN-REFNGLIDCLMKVIKSDGPIGLYRGFIVSVQGIVIYRAAYFGFYDT 206

  Fly   238 TVELLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASA------ 296
            ..:.|     |.|     |.....|::|...:......:.|:|.|.|..::....|...      
  Fly   207 CRDFL-----PNP-----KSTPFYVSWAIAQVVTTVAGIASYPFDTVRRRMMMQSGLKKSEMVYK 261

  Fly   297 ------ISVAKSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVK 334
                  :.:||..|....:.|....||. ||..||...:||.:|
  Fly   262 NTAHCWLVIAKQEGIGAFFKGALSNIIR-GTGGALVLALYDEMK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp2NP_001246757.1 Mito_carr 58..142 CDD:278578 21/91 (23%)
Mito_carr <175..245 CDD:278578 14/75 (19%)
Mito_carr 260..338 CDD:278578 20/87 (23%)
Ant2NP_001259432.1 PTZ00169 15..305 CDD:240302 62/302 (21%)
Mito_carr 17..111 CDD:278578 21/93 (23%)
Mito_carr 119..215 CDD:278578 19/106 (18%)
Mito_carr 218..307 CDD:278578 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.