DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and PRSS27

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:256 Identity:90/256 - (35%)
Similarity:136/256 - (53%) Gaps:23/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ASCTCGVPN-VNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVS 188
            |:..||.|. :||:|||...:..::||...|.|....||||:||.:::|||||||........:.
Human    22 AATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLY 86

  Fly   189 VRLL---QLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWL 250
            ..||   ||.:...|....| |....::..|...:...|:||:.|:.|:|..:.:.|.|||.   
Human    87 QVLLGARQLVQPGPHAMYAR-VRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPD--- 147

  Fly   251 QNFDFQKAI---VAGWGLSQEGG--STSSVLQEVVVPIITNAQC-----RATSY---RSMIVDTM 302
            .:..|:..:   |.|||...|..  ....:||::.||||...:|     :.|.:   ...|.:.|
Human   148 PSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDM 212

  Fly   303 MCAGYVKTGGRDACQGDSGGPLI-VRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :|||: :.|.:|||:|||||||: :..:.:..|||:|:|.|||:.:.||||.||:.:..||
Human   213 LCAGF-EEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/242 (34%)
Tryp_SPc 137..362 CDD:238113 82/241 (34%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 83/242 (34%)
Tryp_SPc 36..275 CDD:238113 84/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.