DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and zgc:153968

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:257 Identity:92/257 - (35%)
Similarity:129/257 - (50%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CASCTCG-VPNVNRIVGGTQVRTNKYPWIAQI--IRGTFLFCGGTLINDRYVLTAAHCVHGMDMR 185
            |....|| .|...||:||.......:||...|  |....|.|||||||..:||:||.|...:...
Zfish    22 CQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGLLCGGTLINREWVLSAAQCFQKLTAS 86

  Fly   186 GVSVRLLQL---DRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS 247
            .:.|.|..|   |.:..|...::.:    .|..||..:..:|||||:|..|:...|.::|.||.:
Zfish    87 NLVVHLGHLSTGDPNVIHNPASQII----NHPKYDSATNKNDIALLKLSTPVSFTDYIKPVCLTA 147

  Fly   248 ----------NWLQNFDFQKAIVAGWGLSQEGGST-SSVLQEVVVPIITNAQCRATSYRSMIVDT 301
                      :|          :.|||....||:. .:.||||.:|:::|..|: ::|.|:|.|.
Zfish   148 SGSSLGKGAVSW----------ITGWGSINTGGTQFPTTLQEVKIPVVSNGDCK-SAYGSLITDG 201

  Fly   302 MMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |:||| ...||:..|.||.||||:.. ...:..:|:.|||.|||:|..|||:||||.|..||
Zfish   202 MICAG-PNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPKNPGVFTRVSEYESWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 86/242 (36%)
Tryp_SPc 137..362 CDD:238113 85/241 (35%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 86/242 (36%)
Tryp_SPc 36..265 CDD:238113 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587767
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.