DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and TPSAB1

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:260 Identity:93/260 - (35%)
Similarity:138/260 - (53%) Gaps:57/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 IVGGTQVRTNKYPW-IAQIIRGTFL--FCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSS 198
            ||||.:...:|:|| ::..:.|.:.  ||||:||:.::|||||||| |.|::.::...:||....
Human    31 IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCV-GPDVKDLAALRVQLREQH 94

  Fly   199 TH-----LGVTRSVA---FAHAHVGYDPVSLVHDIALLRLDQPI------------PLVDTMRPA 243
            .:     |.|:|.:.   |..|.:|       .|||||.|::|:            |..:|..|.
Human    95 LYYQDQLLPVSRIIVHPQFYTAQIG-------ADIALLELEEPVNVSSHVHTVTLPPASETFPPG 152

  Fly   244 CLPSNWLQNFDFQKAIVAGWG--LSQEGGSTSSVLQEVVVPIITNAQCRATSYRS--------MI 298
             :|. |          |.|||  .:.|.......|::|.|||:.|..|.|..:..        ::
Human   153 -MPC-W----------VTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIV 205

  Fly   299 VDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            .|.|:|||..:   ||:|||||||||:.: :..:..|||||:|.|||:|:.||:||||:.||:||
Human   206 RDDMLCAGNTR---RDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

  Fly   363  362
            Human   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/258 (35%)
Tryp_SPc 137..362 CDD:238113 91/258 (35%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 93/260 (36%)
Tryp_SPc 31..267 CDD:214473 91/258 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.