DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:315 Identity:104/315 - (33%)
Similarity:157/315 - (49%) Gaps:43/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 GHKQQILSNVLGVASETPSDTASSLGSTS---LSSSASPV------FPLEGGGAKAFRVNRCASC 127
            |:|....|: .|:..::        ||||   |::||..|      :..:...:||....||.: 
Human   226 GYKNNFYSS-QGIVDDS--------GSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIA- 280

  Fly   128 TCGVPNVN-----RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCV-------- 179
             ||| |:|     |||||.......:||...:.......|||::|...:::||||||        
Human   281 -CGV-NLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPW 343

  Fly   180 HGMDMRGVSVRLLQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPAC 244
            |.....|:      |.:|....|....|....:|..||..:..:||||::|.:|:...|.::|.|
Human   344 HWTAFAGI------LRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVC 402

  Fly   245 LPSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRAT-SYRSMIVDTMMCAGYV 308
            ||:..:.....|...::|||.::|.|.||.||....|.:|...:|.:. .|.::|...|:|||::
Human   403 LPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFL 467

  Fly   309 KTGGRDACQGDSGGPLIV-RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            : |..|:|||||||||:. ::.|:.|.|..|:|.||||...||||..|..:.:||
Human   468 Q-GNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 81/235 (34%)
Tryp_SPc 137..362 CDD:238113 80/234 (34%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060
SRCR_2 190..283 CDD:292133 17/67 (25%)
Tryp_SPc 292..521 CDD:214473 81/235 (34%)
Tryp_SPc 293..524 CDD:238113 82/236 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8579
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.