DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss41

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:258 Identity:86/258 - (33%)
Similarity:128/258 - (49%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SCTCGVPN--VNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHG-MDMRGV 187
            |..||..|  .:|||||.:....::||.|.:.......|||:|::.|:|||||||... :|....
Mouse    71 SMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKW 135

  Fly   188 SVRLLQLDRSSTHLGVTRSVAFAHAHVG-YDPVSLV---------HDIALLRLDQPIPLVDTMRP 242
            :|:|.||....::..       ..|:.| |....::         ||:|||||...:.....::|
Mouse   136 TVQLGQLTSKPSYWN-------RKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTYNKDIQP 193

  Fly   243 ACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSSV---LQEVVVPIITNAQCRAT----SYRSMIVD 300
            .|:..:...:....:..|.|||:.||.......   |:||.|.|:.|::|:..    |...:|..
Mouse   194 VCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITK 258

  Fly   301 TMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            .:.||| .:.|..|.|.|||||||:.. |.::...|:||:|.||.:|:.||:||.||.|..||
Mouse   259 DVFCAG-AEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNVSHYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 80/244 (33%)
Tryp_SPc 137..362 CDD:238113 79/243 (33%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.