DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss56

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:274 Identity:92/274 - (33%)
Similarity:133/274 - (48%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RCASCTCGVPNV----NRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMD 183
            :|.....||.|.    .|||||:...:..:||:.::..|....|||.|:...:|||||||     
Mouse    92 QCGERHQGVANTTRAHGRIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHC----- 151

  Fly   184 MRGVSVRLL--------QLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTM 240
            ..|.|..||        .....:..:.|.|.:    .|..:||.:..:|:||::|..|:......
Mouse   152 FAGASNELLWTVMLAEGPQGEQAEEVQVNRIL----PHPKFDPQTFHNDLALVQLWTPVSPEGPA 212

  Fly   241 RPACLPSNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCA 305
            ||.|||....:........:||||...|.|..|..::|..||:::...|:......:...||:||
Mouse   213 RPICLPQGSREPPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPSTMLCA 277

  Fly   306 GYVKTGGRDACQGDSGGPLIV-------RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI- 362
            ||: .||.|:|||||||||..       |:.:|   ||.|:|.||.:|..|||||||:.:.:|: 
Mouse   278 GYL-AGGIDSCQGDSGGPLTCSEPGPRPREVLF---GVTSWGDGCGEPGKPGVYTRVTVFKDWLQ 338

  Fly   363 -----AVNTRD-SC 370
                 ..:||: ||
Mouse   339 EQMSAGPSTREPSC 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/240 (35%)
Tryp_SPc 137..362 CDD:238113 82/239 (34%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm44284
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.