DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Prss41

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001128559.1 Gene:Prss41 / 681033 RGDID:1584711 Length:324 Species:Rattus norvegicus


Alignment Length:301 Identity:92/301 - (30%)
Similarity:141/301 - (46%) Gaps:46/301 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 VLGVASETPSDTASSLGSTSLSSSASPVFPLEGGGAKAFRVNRCASCTCGVPN--VNRIVGGTQV 143
            :||.......:.|:.|.:|.:...:.|                     ||..|  .:|||||.:.
  Rat    18 MLGEPGSREENQAAGLKNTDIKLLSMP---------------------CGRRNDIRSRIVGGIES 61

  Fly   144 RTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHG-MDMRGVSVRLLQLDRSSTHLGVTRSV 207
            ...::||.|.:....|..|||:|::.|:|||||||... :|.:..:|:|.||   ::........
  Rat    62 VRGRWPWQASLRLRKFHRCGGSLLSHRWVLTAAHCFRKFLDPKKWTVQLGQL---TSKPSFWNRE 123

  Fly   208 AFAHAH------VGYDPVSLVHDIALLRLDQPIPLVDTMRPAC-LPSNWLQNFDFQKAIVAGWGL 265
            ||:..:      :..:.....||:|||||...:.....::|.| |||..:.... .:..|.|||.
  Rat   124 AFSGRYRVKDIIINSEDKLKYHDLALLRLASSVTYNKFIQPVCVLPSASMSQHQ-PRCWVTGWGA 187

  Fly   266 SQEGGSTSSV---LQEVVVPIITNAQCR-----ATSYRSMIVDTMMCAGYVKTGGRDACQGDSGG 322
            .||.......   |:||.|.::..::|:     |:.|. :|...:.||| .:.|..|.|.|||||
  Rat   188 LQEDLKPLPPPYHLREVQVTVLNLSRCQELFSFASRYH-LITRDVFCAG-AEDGSADTCSGDSGG 250

  Fly   323 PLIVR-DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            ||:.. |.::...|:||.|.||.:|..||:||.||.:.:||
  Rat   251 PLVCNMDGLWYQIGIVSRGVGCGRPKLPGIYTNVSHHYDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 81/242 (33%)
Tryp_SPc 137..362 CDD:238113 80/241 (33%)
Prss41NP_001128559.1 Tryp_SPc 54..291 CDD:214473 81/242 (33%)
Tryp_SPc 55..292 CDD:238113 82/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.