DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:238 Identity:81/238 - (34%)
Similarity:130/238 - (54%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 NRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQ-----L 194
            ::||||...:.|..|:...:..| :.||||:|||.::|::||||....    :.|||.:     |
Mouse    23 DKIVGGYTCQRNALPYQVSLNSG-YHFCGGSLINSQWVVSAAHCYKSR----IQVRLGEHNIDAL 82

  Fly   195 DRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPL---VDTMR-PACLPSNWLQNFDF 255
            :.....:...:.:    .|..|:..:..:||.|::|.....|   |.|:. |...||..      
Mouse    83 EGGEQFIDAAKII----RHPNYNANTYNNDIMLIKLKTAATLNSRVSTVALPRSCPSAG------ 137

  Fly   256 QKAIVAGWGLSQEGGST-SSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGD 319
            .:.:|:|||.:...|:. .|:||.:..|:::::.| .:||...|...|.|.|::: ||:|:||||
Mouse   138 TRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSC-TSSYPGKITSNMFCLGFLE-GGKDSCQGD 200

  Fly   320 SGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            ||||::...   :|.||||:|||||:...|||||:|.:|:.||
Mouse   201 SGGPVVCNG---QLQGVVSWGYGCAQRGKPGVYTKVCKYVNWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 79/235 (34%)
Tryp_SPc 137..362 CDD:238113 79/234 (34%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 79/235 (34%)
Tryp_SPc 25..243 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.