DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:321 Identity:111/321 - (34%)
Similarity:170/321 - (52%) Gaps:39/321 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EGHKQQILSNVLGVASETPSDT--ASSLGS------------------TSLSSSASPVFPLEGGG 115
            :||...:....||..|...||.  .|||..                  |:|..|   |:..||..
Human   134 KGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHS---VYVREGCA 195

  Fly   116 AKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVH 180
            :......:|.:|.......:|||||.....:::||.|.:....:..|||::|...:::||||||:
Human   196 SGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVY 260

  Fly   181 GMDMR---GVSVRLLQL--DRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTM 240
            .:.:.   .:.|.|:.|  :.:.:||  ...:.:   |..|.|..|.:||||::|..|:...:.:
Human   261 DLYLPKSWTIQVGLVSLLDNPAPSHL--VEKIVY---HSKYKPKRLGNDIALMKLAGPLTFNEMI 320

  Fly   241 RPACLPSNWLQNF-DFQKAIVAGWGLSQEG-GSTSSVLQEVVVPIITNAQCRATS-YRSMIVDTM 302
            :|.||| |..:|| |.:....:|||.:::| |..|.||....||:|:|..|.... |..:|..:|
Human   321 QPVCLP-NSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSM 384

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :||||: |||.|:|||||||||:.:: |:::|.|..|||.|||:.:.|||||||:.:|:||
Human   385 LCAGYL-TGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/234 (39%)
Tryp_SPc 137..362 CDD:238113 90/233 (39%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 18/78 (23%)
Tryp_SPc 216..444 CDD:214473 91/234 (39%)
Tryp_SPc 217..447 CDD:238113 92/235 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H56985
Inparanoid 1 1.050 175 1.000 Inparanoid score I4057
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.