DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:263 Identity:99/263 - (37%)
Similarity:141/263 - (53%) Gaps:30/263 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CASCTCG-VPNVNRIVGGTQVRTNKYPWIAQIIRGTF--LFCGGTLINDRYVLTAAHCVHGMDMR 185
            |....|| .|...:||||.......:||...:...|:  .||||:|||..:||:||||.  .|..
Zfish    22 CQLNVCGRAPLNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFCGGSLINKDWVLSAAHCF--QDSI 84

  Fly   186 G-VSVRL-LQLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPS- 247
            | :.|:| ||....|....:|::|.....|..|:..|..:||||::||..:...|.:.|.||.: 
Zfish    85 GTIMVKLGLQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCLAAA 149

  Fly   248 ---------NWLQNFDFQKAIVAGWG-LSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTM 302
                     :|          |.||| ||........:||||.:||::::.|: .:|...|...|
Zfish   150 GNTYAAGTLSW----------VTGWGKLSSAANQIPDILQEVEIPIVSHSDCK-RAYPGEITSNM 203

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRD-RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNT 366
            :|||.:..||:|:||||||||::.|: ..:..:|:||||.|||:|..||||.|||:|.:||..:|
Zfish   204 ICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQDWITSST 268

  Fly   367 RDS 369
            ..|
Zfish   269 GSS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/241 (38%)
Tryp_SPc 137..362 CDD:238113 91/240 (38%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 91/241 (38%)
Tryp_SPc 36..264 CDD:238113 91/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587791
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.