DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and PRSS22

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:284 Identity:95/284 - (33%)
Similarity:143/284 - (50%) Gaps:39/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LGSTSLSSSAS-PVFPLEGGGAKAFRVNRCASCTCGVP-NVNRIVGGTQVRTNKYPWIAQIIRGT 158
            |.||::.::|. ||.|                 .||.| .:||:|||.....:::|||..|.:..
Human    24 LASTAILNAARIPVPP-----------------ACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNG 71

  Fly   159 FLFCGGTLINDRYVLTAAHC----VHGMDMRGVSVRLLQLDR---SSTHLGVTRSVAFAHAHVGY 216
            ...|.|:|:..|:|:|||||    ::...:..|.:...||..   .|..:|    ||:...|..|
Human    72 THHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVG----VAWVEPHPVY 132

  Fly   217 D-PVSLVHDIALLRLDQPIPLVDTMRPACLPSNWLQNFDFQKAIVAGWGLSQEGGST--SSVLQE 278
            . ......||||:||::.|...:.:.|.|||...:.........::|||..|:|...  ...||:
Human   133 SWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQK 197

  Fly   279 VVVPIITNAQCRATSYRSM----IVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVS 338
            :.||||.:..|....:|..    |.:.|:||||:: |.||||.|||||||:.: |..:.|||::|
Human   198 LKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLE-GERDACLGDSGGPLMCQVDGAWLLAGIIS 261

  Fly   339 FGYGCAKPDAPGVYTRVSRYLEWI 362
            :|.|||:.:.||||..:|.:..|:
Human   262 WGEGCAERNRPGVYISLSAHRSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 83/240 (35%)
Tryp_SPc 137..362 CDD:238113 82/239 (34%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 83/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.