DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG18735

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:324 Identity:139/324 - (42%)
Similarity:193/324 - (59%) Gaps:31/324 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HKQQILSNVLG-VASETPS-----------DTASSLGSTS----LSSSASPVFPLE-GGGAKAFR 120
            |...||:..|| :|..|||           :..:.|..:|    :.|...|..|.| ...||   
  Fly     5 HLLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAK--- 66

  Fly   121 VNRCASCTCGVPNVN---RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGM 182
             ..||.|:||  |:|   |||||.:...::|||:..::.....:||.:|:||:|.|||||||:|.
  Fly    67 -RECAECSCG--NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGF 128

  Fly   183 DMRGVSVRLLQLDRSSTHLG-VTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP 246
            ..|.::||||:.:|..:|:. |.|.|:....|..|...:...||||:|.::|:.|...|.|.|:|
  Fly   129 YHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193

  Fly   247 SNWLQNFDFQKAIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSY-RSMIVDTMMCAGYVKT 310
            :. .:|:..|.|:|.|||...|||..|..||||.|||::..:||.::| .|.|.|.|:|||||:.
  Fly   194 TP-SENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ 257

  Fly   311 GGRDACQGDSGGPLIV--RDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTRDSCYC 372
            ||:|:||||||||:.|  ....::|||:||:|.|||||:||||||||..:.:|||.||||:|.|
  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSC 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 106/229 (46%)
Tryp_SPc 137..362 CDD:238113 105/228 (46%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 106/229 (46%)
Tryp_SPc 83..314 CDD:238113 108/231 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471768
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
109.900

Return to query results.
Submit another query.