DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and CG34458

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:238 Identity:74/238 - (31%)
Similarity:121/238 - (50%) Gaps:12/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 VPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLD 195
            |...:||:||......::|....:.......|||:||:|..::|||||..|.: .|....::..:
  Fly    26 VAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCTMGQN-PGQMKAIVGTN 89

  Fly   196 RSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPL---VDTMRPACLPSNWLQNFDFQK 257
            ..|...|.|.::|....|..|:|.|...|::|::|..|:|:   |.|::.|...||:..:   ..
  Fly    90 DLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAVQTIQLADSDSNYAAD---TM 151

  Fly   258 AIVAGWGLSQEGGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGG 322
            |:::|:|...:.....:.|:...|.:.:...|.:.:... :.|.|:|||: .:|...:|||||||
  Fly   152 AMISGFGAINQNLQLPNRLKFAQVQLWSRDYCNSQNIPG-LTDRMVCAGH-PSGQVSSCQGDSGG 214

  Fly   323 PLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVN 365
            ||.|..::|   ||||:|:||.....|.:||.|.....||..|
  Fly   215 PLTVDGKLF---GVVSWGFGCGAKGRPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 70/228 (31%)
Tryp_SPc 137..362 CDD:238113 69/227 (30%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 70/228 (31%)
Tryp_SPc 32..254 CDD:238113 71/230 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 1 1.000 - - otm25354
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.