DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:262 Identity:92/262 - (35%)
Similarity:142/262 - (54%) Gaps:34/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGVPNVN---RIVGGTQVRTNKYPWIAQIIRGTF-LFCGGTLINDRYVLTAAHCVHGMDMRGVSV 189
            ||.||..   |||||.......:||:.. ::|.: .||||:|||:::|||||||:  :|....|:
Zfish    25 CGRPNPTLNPRIVGGVNATHGAWPWMVS-LQGRYGHFCGGSLINNQWVLTAAHCI--VDQTPSSI 86

  Fly   190 RLLQLDRSSTHL----GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSNWL 250
             ::.|.:..:::    .::|::.....|..|..::..:|||||:|...:...|.::|.||..   
Zfish    87 -IVYLGKWRSYVADVNSISRTIRHIIPHPSYSNITKDNDIALLQLTSTVQYTDYIKPICLAD--- 147

  Fly   251 QNFDFQKAI---VAGWG----LSQEG--GSTS--------SVLQEVVVPIITNAQCRATSYRSMI 298
            :|.:|.:..   |||||    |...|  |.|:        .:|||..:.:.:||.|....: ..|
Zfish   148 ENSNFPRGTNSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICH-GRI 211

  Fly   299 VDTMMCAGYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIA 363
            ...|:||| .:.||:....|||||||:.:..::..|||:|.|||||:|:.|.|:.|||.|.:||.
Zfish   212 TPNMICAG-TRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWIT 275

  Fly   364 VN 365
            .|
Zfish   276 GN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/247 (34%)
Tryp_SPc 137..362 CDD:238113 84/246 (34%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.