DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:116 Identity:46/116 - (39%)
Similarity:68/116 - (58%) Gaps:23/116 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 LQEVVVPIITNAQCR----ATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVRD-RIFRLAG 335
            ||:.|||::.|:.|.    ||     |.|.|||||.:: ||:|.||||||||::.:. .::..:|
Zfish    16 LQQTVVPVVINSDCNNLLGAT-----ITDNMMCAGLLQ-GGKDTCQGDSGGPMVSQQCSVWVQSG 74

  Fly   336 VVSFGYGCAKPDAPGVYTRVSRYLEW------------IAVNTRDSCYCIN 374
            ::|.|:.|.:|..||||||||:|..|            |..|..:||:.::
Zfish    75 IISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQNLPGFITFNPLNSCFSVS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 42/102 (41%)
Tryp_SPc 137..362 CDD:238113 42/102 (41%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 42/92 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.