DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and zgc:112285

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001020685.1 Gene:zgc:112285 / 561476 ZFINID:ZDB-GENE-050913-132 Length:316 Species:Danio rerio


Alignment Length:271 Identity:102/271 - (37%)
Similarity:136/271 - (50%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 CGV----PN-VNRIVGGTQVRTNKYPWIAQI---IRGTFLF---CGGTLINDRYVLTAAHCVH-G 181
            ||:    || |.|||.|.:.|.:.:||...:   .||:..:   ||||||:..:|||||||.. |
Zfish    46 CGLAHFKPNTVERIVSGNEARPHSWPWQVSLQVRPRGSKHYVHVCGGTLIHKNWVLTAAHCFQKG 110

  Fly   182 MDMRGVSVRLL----QLDRSST---HLGVTRSVAFAHAHVGYDPVS-LVHDIALLRLDQPIPLVD 238
            ......|.|::    ||.||.|   ...|.|  .:.|.|..|...| |.:||||::....|...:
Zfish   111 KAEDASSWRIVLGKHQLKRSETAERFFPVKR--IYRHEHFRYPAHSELDYDIALVKAATDIQPSN 173

  Fly   239 TMRPACLPSNWLQNFDFQKAIVAGWGLSQEGG----STSSVLQEVVVPIITNAQCRATSY-RSMI 298
            .:|.||||...:.........|.||| ...||    |.:..|.:..:|||....||...: ...:
Zfish   174 FIRYACLPRKQINLNPGHYCWVTGWG-DTRGGKENVSLAEALNQARLPIIDYKTCRQKKFWGDRV 237

  Fly   299 VDTMMCAGYVKTGGRD-ACQGDSGGPLIV---RDRIFRLAGVVSFG-YGCAKPDAPGVYTRVSRY 358
            .|:|:|||:..|.|.. ||||||||||:.   ||| :.:.|:|||| .||...:.|.|:||.:.|
Zfish   238 RDSMICAGFRDTEGTPAACQGDSGGPLLCQVGRDR-WEVHGIVSFGPIGCTVENKPSVFTRTAAY 301

  Fly   359 LEWI-AVNTRD 368
            :.|| |...||
Zfish   302 IPWIEATRIRD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 92/250 (37%)
Tryp_SPc 137..362 CDD:238113 91/249 (37%)
zgc:112285NP_001020685.1 Tryp_SPc 58..305 CDD:214473 92/250 (37%)
Tryp_SPc 59..308 CDD:238113 93/252 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.