DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:252 Identity:92/252 - (36%)
Similarity:133/252 - (52%) Gaps:13/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CASCTCGVPNVNRIVGGTQVRTNKYPWIAQI--IRGTFLFCGGTLINDRYVLTAAHCVHGMDMRG 186
            |....||...:|...||.......:||.|.|  |......|||:|||..:||:||||.  |....
Zfish    22 CQLDVCGQAPLNNNNGGDDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCF--MITAT 84

  Fly   187 VSVRLL---QLDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLPSN 248
            .::::.   |....|....::|::.....|..|...:..:|||||||...:...|.:||.||.|.
Zfish    85 ANIKIFLGRQFQTGSNPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASA 149

  Fly   249 WLQNFDFQKAIVAGWGLSQEGG-STSSVLQEVVVPIITNAQCRATSYRSMIVDTMMCAGYVKTGG 312
            ........|:.:.||...:... ..::|||||.:|:::|.:|.| .|:.:|.|.|:||| :..||
Zfish   150 DSVFAGGTKSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNA-DYKGIITDNMICAG-INEGG 212

  Fly   313 RDACQGDSGGPLIVRD--RIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWIAVNTR 367
            :||||||||||::.::  |..: :|:||||..|..|..||:|||||:|..||....|
Zfish   213 KDACQGDSGGPMVSQNGSRWIQ-SGIVSFGRECGLPRYPGIYTRVSQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/233 (36%)
Tryp_SPc 137..362 CDD:238113 85/232 (37%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 85/230 (37%)
Tryp_SPc 37..263 CDD:238113 85/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587785
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.