DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and prss60.2

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:272 Identity:99/272 - (36%)
Similarity:143/272 - (52%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CASCT--------------CG-VPNVNRIVGGTQVRTNKYPWIAQIIRGTF--LFCGGTLINDRY 171
            ||:.|              || .|..:|||||.......:||...:....:  .||||:||:..:
Zfish     6 CATLTLLICVKGSLSQLNVCGQAPLNSRIVGGVNAPEGSWPWQVSLQSPRYGGHFCGGSLISSEW 70

  Fly   172 VLTAAHCVHGMDMRGVSVRLLQLDRS--STHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPI 234
            |||||||:.|:....:.|.|.:..:.  :|| ..:|:||....|..|:..:..:|||||||...:
Zfish    71 VLTAAHCLPGVSESSLVVYLGRRTQQGVNTH-ETSRNVAKIIVHSSYNSNTNDNDIALLRLSSAV 134

  Fly   235 PLVDTMRPACL----------PSNWLQNFDFQKAIVAGWGLSQEGGS--TSSVLQEVVVPIITNA 287
            ...|.:||.||          .|:|          :.|||..|.|.:  ...:|||.::|::.|.
Zfish   135 TFNDYIRPVCLAAQNSVYSAGTSSW----------ITGWGDVQAGVNLPAPGILQETMIPVVAND 189

  Fly   288 QCRATSYRSMIVDTMMCAGYVKTGGRDACQGDSGGPLIVR-DRIFRLAGVVSFGYGCAKPDAPGV 351
            :|.|......:.:.|:|||..| ||:|.||||||||::.| ..::..||:.|:|||||.|::|||
Zfish   190 RCNAQLGSGTVTNNMICAGLAK-GGKDTCQGDSGGPMVTRLCTVWIQAGITSWGYGCADPNSPGV 253

  Fly   352 YTRVSRYLEWIA 363
            |||||:|..||:
Zfish   254 YTRVSQYQSWIS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 91/242 (38%)
Tryp_SPc 137..362 CDD:238113 90/241 (37%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 91/242 (38%)
Tryp_SPc 34..267 CDD:238113 92/244 (38%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587890
Domainoid 1 1.000 191 1.000 Domainoid score I3175
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6349
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.