DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and epsilonTry

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:234 Identity:87/234 - (37%)
Similarity:131/234 - (55%) Gaps:21/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 RIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHCVHGMDMRGVSVRLLQLDRSSTH 200
            |||||.:...:.:|:...:.|....||||::.:...|:|||||:..::.:.:.:|:     .||:
  Fly    30 RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRV-----GSTY 89

  Fly   201 L---GVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACL-PSNWLQNFDFQKAIVA 261
            .   |...||.....|.||:..::|:|||::|::..:....::|...: .||..:.   ..|:|:
  Fly    90 WRSGGSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREG---ATAVVS 151

  Fly   262 GWGLSQEGGST-SSVLQEVVVPIITNAQCRAT--SYRSMIVDTMMCAGYVKTGGRDACQGDSGGP 323
            |||.::.|||| ...|..|.:.||..::||:.  .|...|.|||:|| |..  .:||||||||||
  Fly   152 GWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCA-YAP--HKDACQGDSGGP 213

  Fly   324 LIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            |:..|   ||.||||:||||.....||||..|:.:.|||
  Fly   214 LVSGD---RLVGVVSWGYGCGDVRYPGVYADVAHFHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 85/232 (37%)
Tryp_SPc 137..362 CDD:238113 84/231 (36%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 85/232 (37%)
Tryp_SPc 31..252 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.