DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4613 and Gm5771

DIOPT Version :9

Sequence 1:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:255 Identity:89/255 - (34%)
Similarity:138/255 - (54%) Gaps:33/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GGAKAFRVNRCASCTCGVPNVNRIVGGTQVRTNKYPWIAQIIRGTFLFCGGTLINDRYVLTAAHC 178
            |.|.||.|:.           ::||||...|.|..|:...:..| :.||||:||||::|::||||
Mouse    11 GAAVAFPVDD-----------DKIVGGYTCRENSVPYQVSLNSG-YHFCGGSLINDQWVVSAAHC 63

  Fly   179 VHGMDMRGVSVRLLQ-----LDRSSTHLGVTRSVAFAHAHVGYDPVSLVHDIALLRLDQPIPLVD 238
            .    ...:.|||.:     |:.:...:...:.:    .|..::..:|.:||.|::|..|:.|..
Mouse    64 Y----KTRIQVRLGEHNIKVLEGNEQFVNAAKII----KHPNFNRKTLNNDIMLIKLSSPVTLNA 120

  Fly   239 TMRPACLPSNWLQNFDFQKAIVAGWGLSQE-GGSTSSVLQEVVVPIITNAQCRATSYRSMIVDTM 302
            .:....|||:...  ...:.:::|||.:.. |.|...:||.:..|::..|.|.| ||...|...|
Mouse   121 RVATVALPSSCAP--AGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEA-SYPGKITGNM 182

  Fly   303 MCAGYVKTGGRDACQGDSGGPLIVRDRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362
            :|||::: ||:|:||||||||::...   .|.|:||:|||||..|.|||||:|..|::||
Mouse   183 VCAGFLE-GGKDSCQGDSGGPVVCNG---ELQGIVSWGYGCALADNPGVYTKVCNYVDWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 82/231 (35%)
Tryp_SPc 137..362 CDD:238113 82/230 (36%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 82/231 (35%)
Tryp_SPc 23..241 CDD:238113 84/232 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.